Efhd2, Recombinant, Mouse, aa2-240, His-SUMO-Tag (EF-hand Domain-containing Protein D2)

Product Overview

• Article Name: Efhd2, Recombinant, Mouse, aa2-240, His-SUMO-Tag (EF-hand Domain-containing Protein D2)
• Biozol Catalog Number: USB-373134
• Supplier Catalog Number: 373134
• Alternative Catalog Number: USB-373134-20,USB-373134-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

May regulate B-cell receptor (BCR)-induced immature and primary B-cell apoptosis. Plays a role as negative regulator of the canonical NF-kappa-B-activating branch. Controls spontaneous apoptosis through the regulation of BCL2L1 abundance. Source: Recombinant protein corresponding to aa2-240 from mouse Efhd2, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~42.7kD Amino Acid Sequence: ATDELASKLSRRLQMEGEGGEATEQPGLNGAAAAAAAEAPDETAQALGSADDELSAKLLRRADLNQGIGEPQSPSRRVFNPYTEFKEFSRKQIKDMEKMFKQYDAGRDGFIDLMELKLMMEKLGAPQTHLGLKSMIQEVDEDFDSKLSFREFLLIFRKAAAGELQEDSGLQVLARLSEIDVSTEGVKGAKNFFEAKVQAINVSSRFEEEIKAEQEERKKQAEEVKQRKAAFKELQSTFK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 42.7
• UniProt: Q9D8Y0
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.