EIF1, Recombinant, Human, aa1-113, GST-Tag (Eukaryotic Translation Initiation Factor 1)

Catalog Number: USB-373150
Article Name: EIF1, Recombinant, Human, aa1-113, GST-Tag (Eukaryotic Translation Initiation Factor 1)
Biozol Catalog Number: USB-373150
Supplier Catalog Number: 373150
Alternative Catalog Number: USB-373150-20,USB-373150-100,USB-373150-1
Manufacturer: US Biological
Category: Molekularbiologie
Necessary for scanning and involved in initiation site selection. Promotes the assembly of 48S ribosomal complexes at the authentic initiation codon of a conventional capped mRNA. Source: Recombinant protein corresponding to aa1-113 from human EIF1, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~39.7kD Amino Acid Sequence: MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 39.7
UniProt: P41567
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.