EIF4EBP3, Recombinant, Human, aa1-100, His-SUMO-Tag (Eukaryotic Translation Initiation Factor 4E-binding Protein 3)

Catalog Number: USB-373163
Article Name: EIF4EBP3, Recombinant, Human, aa1-100, His-SUMO-Tag (Eukaryotic Translation Initiation Factor 4E-binding Protein 3)
Biozol Catalog Number: USB-373163
Supplier Catalog Number: 373163
Alternative Catalog Number: USB-373163-20,USB-373163-100,USB-373163-1
Manufacturer: US Biological
Category: Molekularbiologie
Repressor of translation initiation that regulates EIF4E activity by preventing its assembly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. Source: Recombinant protein corresponding to aa1-100 from human EIF4EBP3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.9kD Amino Acid Sequence: MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 26.9
UniProt: O60516
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.