EML2, Recombinant, Human, aa1-418, His-SUMO-Tag (Echinoderm Microtubule-associated Protein-like 2)

Catalog Number: USB-373177
Article Name: EML2, Recombinant, Human, aa1-418, His-SUMO-Tag (Echinoderm Microtubule-associated Protein-like 2)
Biozol Catalog Number: USB-373177
Supplier Catalog Number: 373177
Alternative Catalog Number: USB-373177-20,USB-373177-100,USB-373177-1
Manufacturer: US Biological
Category: Molekularbiologie
Tubulin binding protein that inhibits microtubule nucleation and growth, resulting in shorter microtubules. Source: Recombinant protein corresponding to aa1-418 from human EML2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~61.8kD Amino Acid Sequence: MSSFGAGKTKEVIFSVEDGSVKMFLRGRPVPMMIPDELAPTYSLDTRSELPSCRLKLEWVYGYRGRDCRANLYLLPTGEIVYFVASVAVLYSVEEQRQRHYLGHNDDIKCLAIHPDMVTIATGQVAGTTKEGKPLPPHVRIWDSVSLSTLHVLGLGVFDRAVCCVGFSKSNGGNLLCAVDESNDHMLSVWDWAKETKVVDVKCSNEAVLVATFHPTDPTVLITCGKSHIYFWTLEGGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNLYVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGGRDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQFVTCGQDKLVHLWSSDSHQPLWSRIIE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 61.8
UniProt: O95834
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.