ENPEP, Recombinant, Human, aa719-949, His-Tag (Glutamyl Aminopeptidase)

Catalog Number: USB-373185
Article Name: ENPEP, Recombinant, Human, aa719-949, His-Tag (Glutamyl Aminopeptidase)
Biozol Catalog Number: USB-373185
Supplier Catalog Number: 373185
Alternative Catalog Number: USB-373185-20,USB-373185-100,USB-373185-1
Manufacturer: US Biological
Category: Molekularbiologie
Appears to have a role in the catabolic pathway of the renin-angiotensin system. Probably plays a role in regulating growth and differentiation of early B-lineage cells. Source: Recombinant protein corresponding to aa719-949 from human Glutamyl Aminopeptidase, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.0kD Amino Acid Sequence: YFQGQVKPIADSLGWNDAGDHVTKLLRSSVLGFACKMGDREALNNASSLFEQWLNGTVSLPVNLRLLVYRYGMQNSGNEISWNYTLEQYQKTSLAQEKEKLLYGLASVKNVTLLSRYLDLLKDTNLIKTQDVFTVIRYISYNSYGKNMAWNWIQLNWDYLVNRYTLNNRNLGRIVTIAEPFNTELQLWQMESFFAKYPQAGAGEKPREQVLETVKNNIEWLKQHRNTIREW Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 31
UniProt: Q07075
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.