ENSA, Recombinant, Human, aa1-121, GST-Tag (Alpha-endosulfine)

Catalog Number: USB-373186
Article Name: ENSA, Recombinant, Human, aa1-121, GST-Tag (Alpha-endosulfine)
Biozol Catalog Number: USB-373186
Supplier Catalog Number: 373186
Alternative Catalog Number: USB-373186-20,USB-373186-100,USB-373186-1
Manufacturer: US Biological
Category: Molekularbiologie
Protein phosphatase inhibitor that specifically inhibits protein phosphatase 2A (PP2A) during mitosis. When phosphorylated at Ser-67 during mitosis, specifically interacts with PPP2R2D (PR55-delta) and inhibits its activity, leading to inactivation of PP2A, an essential condition to keep cyclin-B1-CDK1 activity high during M phase. Also acts as a stimulator of insulin secretion by interacting with sulfonylurea receptor (ABCC8), thereby preventing sulfonylurea from binding to its receptor and reducing K(ATP) channel currents.1 Publication Source: Recombinant protein corresponding to aa1-121 from human ENSA, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~40.4kD Amino Acid Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQVE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 40.4
UniProt: O43768
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.