Enterotoxin Type B, Recombinant, Staphylococcus Aureus, aa28-266, His-Tag (EntB, SEB)

Catalog Number: USB-373189
Article Name: Enterotoxin Type B, Recombinant, Staphylococcus Aureus, aa28-266, His-Tag (EntB, SEB)
Biozol Catalog Number: USB-373189
Supplier Catalog Number: 373189
Alternative Catalog Number: USB-373189-20, USB-373189-100
Manufacturer: US Biological
Category: Molekularbiologie
Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Full-length recombinant protein corresponding to aa28-266 from Staphylococcus aureus EntB, fused to 6X His-Tag at N-terminal, expressed in Yeast. Swiss/UniProt Accession: P01552. Molecular Weight: ~30.4kD Amino Acid Sequence: ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 30.4
UniProt: P01552
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 50% glycerol.