Enterotoxin Type H, Recombinant, Staphylococcus aureus, aa25-241, His-Tag (EntH, SEH)

Catalog Number: USB-373198
Article Name: Enterotoxin Type H, Recombinant, Staphylococcus aureus, aa25-241, His-Tag (EntH, SEH)
Biozol Catalog Number: USB-373198
Supplier Catalog Number: 373198
Alternative Catalog Number: USB-373198-20,USB-373198-100
Manufacturer: US Biological
Category: Molekularbiologie
Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Source: Recombinant protein corresponding to aa25-241 from staphylococcus aureus Enterotoxin Type H, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.1kD Amino Acid Sequence: EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKKKV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 27.1
UniProt: P0A0M0
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.