Erap1, Recombinant, Mouse, aa731-930, His-Tag (Endoplasmic Reticulum Aminopeptidase 1)

Catalog Number: USB-373209
Article Name: Erap1, Recombinant, Mouse, aa731-930, His-Tag (Endoplasmic Reticulum Aminopeptidase 1)
Biozol Catalog Number: USB-373209
Supplier Catalog Number: 373209
Alternative Catalog Number: USB-373209-20, USB-373209-100
Manufacturer: US Biological
Category: Molekularbiologie
Aminopeptidase that plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. Peptide trimming is essential to customize longer precursor peptides to fit them to the correct length required for presentation on MHC class I molecules. Strongly prefers substrates 9-16 residues long. Rapidly degrades 13-mer to a 9-mer and then stops. Preferentially hydrolyzes the residue Leu and peptides with a hydrophobic C-terminus, while it has weak activity toward peptides with charged C-terminus. May play a role in the inactivation of peptide hormones. May be involved in the regulation of blood pressure through the inactivation of angiotensin II and/or the generation of bradykinin in the kidney (By similarity). Source: Recombinant protein corresponding to aa731-930 from mouse Erap1, fused to His-Tag at N-terminal and Myc-Tag at C-terminal expressed in E.coli. Molecular Weight: ~28.3kD Amino Acid Sequence: PCVQRAERYFREWKSSNGNMSIPIDVTLAVFAVGAQNTEGWDFLYSKYQSSLSSTEKSQIEFSLCTSKDPEKLQWLLDQSFKGEIIKTQEFPHILTLIGRNPVGYPLAWKFLRENWNKLVQKFELGSSSIAHMVMGTTDQFSTRARLEEVKGFFSSLKENGSQLRCVQQTIETIEENIRWMDKNFDKIRLWLQKEKPELL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 28.3
UniProt: Q9EQH2
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.