ERAS, Recombinant, Human, aa3-230, His-Tag (GTPase ERas)

Catalog Number: USB-373210
Article Name: ERAS, Recombinant, Human, aa3-230, His-Tag (GTPase ERas)
Biozol Catalog Number: USB-373210
Supplier Catalog Number: 373210
Alternative Catalog Number: USB-373210-20,USB-373210-100,USB-373210-1
Manufacturer: US Biological
Category: Molekularbiologie
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the tumor-like growth properties of embryonic stem cells. Partial recombinant protein corresponding to aa3-230 from human ERAS, fused to His-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot Number: Q7Z444 Molecular Weight: ~28.8kD Amino Acid Sequence: LPTKPGTFDLGLATWSPSFQGETHRAQARRRDVGRQLPEYKAVVVGASGVGKSALTIQLNHQCFVEDHDPTIQDSYWKELTLDSGDCILNVLDTAGQAIHRALRDQCLAVCDGVLGVFALDDPSSLIQLQQIWATWGPHPAQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAFSLLVHEIQRVQEAMAKEPMARSCREKTRHQKATCHCGC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 28.8
UniProt: Q7Z444
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.