ERCC5, Recombinant, Human, aa947-1186, His-Tag (DNA Repair Protein Complementing XP-G Cells)

Catalog Number: USB-373212
Article Name: ERCC5, Recombinant, Human, aa947-1186, His-Tag (DNA Repair Protein Complementing XP-G Cells)
Biozol Catalog Number: USB-373212
Supplier Catalog Number: 373212
Alternative Catalog Number: USB-373212-20,USB-373212-100
Manufacturer: US Biological
Category: Molekularbiologie
Single-stranded structure-specific DNA endonuclease involved in DNA excision repair. Makes the 3incision in DNA nucleotide excision repair (NER). Acts as a cofactor for a DNA glycosylase that removes oxidized pyrimidines from DNA. May also be involved in transcription-coupled repair of this kind of damage, in transcription by RNA polymerase II, and perhaps in other processes too. Source: Recombinant protein corresponding to aa947-1186 from human ERCC5, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.8kD Amino Acid Sequence: SFLWGKPDLDKIREFCQRYFGWNRTKTDESLFPVLKQLDAQQTQLRIDSFFRLAQQEKEDAKRIKSQRLNRAVTCMLRKEKEAAASEIEAVSVAMEKEFELLDKAKGKTQKRGITNTLEESSSLKRKRLSDSKGKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVKNGGATTSSSSDSDDDGGKEKMVLVTARSVFGKKRRKLRRARGRKRKT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 30.8
UniProt: P28715
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.