ERP29, Recombinant, Human, aa40-251, GST-Tag (Endoplasmic Reticulum Resident Protein 29)

Product Overview

• Article Name: ERP29, Recombinant, Human, aa40-251, GST-Tag (Endoplasmic Reticulum Resident Protein 29)
• Biozol Catalog Number: USB-373218
• Supplier Catalog Number: 373218
• Alternative Catalog Number: USB-373218-20,USB-373218-100,USB-373218-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER. Source: Partial recombinant protein corresponding to aa40-251 from human ERP29, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~51.0kD Amino Acid Sequence: PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 51
• UniProt: P30040
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.