Ezrin, Recombinant, Human, aa1-251, His-SUMO-Tag (EZR)

Catalog Number: USB-373248
Article Name: Ezrin, Recombinant, Human, aa1-251, His-SUMO-Tag (EZR)
Biozol Catalog Number: USB-373248
Supplier Catalog Number: 373248
Alternative Catalog Number: USB-373248-20,USB-373248-100,USB-373248-1
Manufacturer: US Biological
Category: Molekularbiologie
Probably involved in connections of major cytoskeletal structures to the plasma membrane. In epithelial cells, required for the formation of microvilli and membrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis. Source: Partial recombinant protein corresponding to aa1-251 from human Ezrin, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.4kD Amino Acid Sequence: MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 45.4
UniProt: P15311
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.