Fabp3, Recombinant, Rat, aa2-133, His-SUMO-Tag (Fatty Acid-binding Protein, Heart)

Product Overview

• Article Name: Fabp3, Recombinant, Rat, aa2-133, His-SUMO-Tag (Fatty Acid-binding Protein, Heart)
• Biozol Catalog Number: USB-373254
• Supplier Catalog Number: 373254
• Alternative Catalog Number: USB-373254-20,USB-373254-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters. Source: Recombinant protein corresponding to aa2-133 from rat Fabp3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.6kD Amino Acid Sequence: ADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 30.6
• UniProt: P07483
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.