FadL, Recombinant, E. coli, aa26-446, His-SUMO-Tag (Long-Chain Fatty Acid Transport Protein)

Product Overview

• Article Name: FadL, Recombinant, E. coli, aa26-446, His-SUMO-Tag (Long-Chain Fatty Acid Transport Protein)
• Biozol Catalog Number: USB-373258
• Supplier Catalog Number: 373258
• Alternative Catalog Number: USB-373258-20, USB-373258-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Involved in translocation of long-chain fatty acids across the outer membrane. FadL may form a specific channel. Source: Recombinant protein corresponding to aa26-446 from E. coli fadL, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~61.9kD Amino Acid Sequence: AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGKTPQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRVFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 61.9
• UniProt: Q8XCN6
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.