FASLG, Recombinant, Human, aa103-281, His-Tag (Tumor Necrosis Factor Ligand Superfamily Member 6)

Catalog Number: USB-373279
Article Name: FASLG, Recombinant, Human, aa103-281, His-Tag (Tumor Necrosis Factor Ligand Superfamily Member 6)
Biozol Catalog Number: USB-373279
Supplier Catalog Number: 373279
Alternative Catalog Number: USB-373279-20, USB-373279-100
Manufacturer: US Biological
Category: Molekularbiologie
Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. May be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. Binding to the decoy receptor TNFRSF6B/DcR3 modulates its effects. Source: Recombinant protein corresponding to aa103-281 from human FASLG, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~22.4kD Amino Acid Sequence: QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 22.4
UniProt: P48023
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.