FBXL18, Recombinant, Human, aa1-365, His-SUMO-Tag (F-box/LRR-repeat Protein 18)

Product Overview

• Article Name: FBXL18, Recombinant, Human, aa1-365, His-SUMO-Tag (F-box/LRR-repeat Protein 18)
• Biozol Catalog Number: USB-373288
• Supplier Catalog Number: 373288
• Alternative Catalog Number: USB-373288-20, USB-373288-100, USB-373288-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex. Source: Recombinant protein corresponding to aa1-365 from human FBXL18, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~56.2kD Amino Acid Sequence: MASSGEDISNDDDDMHPAAAGMADGVHLLGFSDEILLHILSHVPSTDLILNVRRTCRKLAALCLDKSLIHTVLLQKDYQASEDKVRQLVKEIGREIQQLSMAGCYWLPGSTVEHVARCRSLVKVNLSGCHLTSLRLSKMLSALQHLRSLAIDVSPGFDASQLSSECKATLSRVRELKQTLFTPSYGVVPCCTSLEKLLLYFEILDRTREGAILSGQLMVGQSNVPHYQNLRVFYARLAPGYINQEVVRLYLAVLSDRTPQNLHAFLISVPGSFAESGATKNLLDSMARNVVLDALQLPKSWLNGSSLLQHMKFNNPFYFSFSRCTLSGGHLIQQVINGGKDLRSLASLNLSGCVHCLSPDSLLCR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 56.2
• UniProt: Q96ME1
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.