FGF-21, Recombinant, Human, aa29-209, His-Tag (Fibroblast Growth Factor 21 Protein)

Catalog Number: USB-373311
Article Name: FGF-21, Recombinant, Human, aa29-209, His-Tag (Fibroblast Growth Factor 21 Protein)
Biozol Catalog Number: USB-373311
Supplier Catalog Number: 373311
Alternative Catalog Number: USB-373311-20,USB-373311-100
Manufacturer: US Biological
Category: Molekularbiologie
Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB. Source: Recombinant protein corresponding to aa29-209 from human FGF-21, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.4kD Amino Acid Sequence: HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 23.4
UniProt: Q9NSA1
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.