FGF1, Recombinant, Mouse, aa16-155, His-Tag (Fibroblast Growth Factor 1)

Catalog Number: USB-373313
Article Name: FGF1, Recombinant, Mouse, aa16-155, His-Tag (Fibroblast Growth Factor 1)
Biozol Catalog Number: USB-373313
Supplier Catalog Number: 373313
Alternative Catalog Number: USB-373313-20,USB-373313-100
Manufacturer: US Biological
Category: Molekularbiologie
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Source: Recombinant protein corresponding to aa16-155 from mouse Fibroblast Growth Factor 1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~19.8kD Amino Acid Sequence: FNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 19.8
UniProt: P61148
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.