Fibroblast Growth Factor 23, Recombinant, Rat, aa25-251, His-Tag (Fgf23)
Biozol Catalog Number:
USB-373321
Supplier Catalog Number:
373321
Alternative Catalog Number:
USB-373321-20, USB-373321-100
Manufacturer:
US Biological
Category:
Molekularbiologie
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL. Full-length recombinant protein corresponding to aa25-251 from rat Fibroblast Growth Factor 23, fused to 6X His-Tag at N-terminal, expressed in E. coli. Swiss/UniProt: Q8VI82 Molecular Weight: ~29.5kD Amino Acid Sequence: YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.