FGF5, Recombinant, Human, aa18-268, GST-Tag (Fibroblast Growth Factor 5 Protein)

Catalog Number: USB-373322
Article Name: FGF5, Recombinant, Human, aa18-268, GST-Tag (Fibroblast Growth Factor 5 Protein)
Biozol Catalog Number: USB-373322
Supplier Catalog Number: 373322
Alternative Catalog Number: USB-373322-20,USB-373322-100,USB-373322-1
Manufacturer: US Biological
Category: Molekularbiologie
Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase. Source: Recombinant protein corresponding to aa18-268 from human FGF5, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~54.6kD Amino Acid Sequence: AWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 54.6
UniProt: P12034
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.