FHIT, Recombinant, Mouse, aa2-150, His-Tag (Bis(5-adenosyl)-triphosphatase)

Catalog Number: USB-373331
Article Name: FHIT, Recombinant, Mouse, aa2-150, His-Tag (Bis(5-adenosyl)-triphosphatase)
Biozol Catalog Number: USB-373331
Supplier Catalog Number: 373331
Alternative Catalog Number: USB-373331-20,USB-373331-100
Manufacturer: US Biological
Category: Molekularbiologie
Cleaves P(1)-P(3)-bis(5-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P(1)-P(4)-bis(5-adenosyl) tetraphosphate (Ap4A), but has extremely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P(1)-P(3)-bis(5-adenosyl) triphosphate or related compounds, but does not require its catalytic activity. Functions as tumor suppressor. Source: Recombinant protein corresponding to aa2-150 from mouse FHIT, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.1kD Amino Acid Sequence: SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALRVYFQA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 21.1
UniProt: O89106
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.