FIBIN, Recombinant, Human, aa19-211, His-SUMO-Tag (Fin Bud Initiation Factor Homolog)

Catalog Number: USB-373335
Article Name: FIBIN, Recombinant, Human, aa19-211, His-SUMO-Tag (Fin Bud Initiation Factor Homolog)
Biozol Catalog Number: USB-373335
Supplier Catalog Number: 373335
Alternative Catalog Number: USB-373335-20,USB-373335-100,USB-373335-1
Manufacturer: US Biological
Category: Molekularbiologie
Source: Recombinant protein corresponding to aa19-211 from human FIBIN, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.1kD Amino Acid Sequence: YFDGPLYPEMSNGTLHHYFVPDGDYEENDDPEKCQLLFRVSDHRRCSQGEGSQVGSLLSLTLREEFTVLGRQVEDAGRVLEGISKSISYDLDGEESYGKYLRRESHQIGDAYSNSDKSLTELESKFKQGQEQDSRQESRLNEDFLGMLVHTRSLLKETLDISVGLRDKYELLALTIRSHGTRLGRLKNDYLKV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 38.1
UniProt: Q8TAL6
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.