Fibritin, Recombinant, Enterobacteria phage T4, aa2-487, His-SUMO-Tag (Wac)

Catalog Number: USB-373337
Article Name: Fibritin, Recombinant, Enterobacteria phage T4, aa2-487, His-SUMO-Tag (Wac)
Biozol Catalog Number: USB-373337
Supplier Catalog Number: 373337
Alternative Catalog Number: USB-373337-20,USB-373337-100
Manufacturer: US Biological
Category: Molekularbiologie
Chaperone responsible for attachment of long tail fibers to virus particle. During phage assembly, twelve fibritin molecules attach to the phage neck via gp13: six molecules forming the collar and six molecules forming the whiskers. Source: Recombinant protein corresponding to aa2-487 from enterobacteria phage T4 wac, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~67.7kD Amino Acid Sequence: TDIVLNDLPFVDGPPAEGQSRISWIKNGEEILGADTQYGSEGSMNRPTVSVLRNVEVLDKNIGILKTSLETANSDIKTIQGILDVSGDIEALAQIGINKKDISDLKTLTSEHTEILNGTNNTVDSILADIGPFNAEANSVYRTIRNDLLWIKRELGQYTGQDINGLPVVGNPSSGMKHRIINNTDVITSQGIRLSELETKFIESDVGSLTIEVGNLREELGPKPPSFSQNVYSRLNEIDTKQTTVESDISAIKTSIGYPGNNSIITSVNTNTDNIASINLELNQSGGIKQRLTVIETSIGSDDIPSSIKGQIKDNTTSIESLNGIVGENTSSGLRANVSWLNQIVGTDSSGGQPSPPGSLLNRVSTIETSVSGLNNAVQNLQVEIGNNSAGIKGQVVALNTLVNGTNPNGSTVEERGLTNSIKANETNIASVTQEVNTAKGNISSLQGDVQALQEAGYIPEAPRDGQAYVRKDGEWVFLSTFLSPA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 67.7
UniProt: P10104
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.