FIGF, Recombinant, Human, aa89-205, GST-Tag (Vascular Endothelial Growth Factor D)

Catalog Number: USB-373338
Article Name: FIGF, Recombinant, Human, aa89-205, GST-Tag (Vascular Endothelial Growth Factor D)
Biozol Catalog Number: USB-373338
Supplier Catalog Number: 373338
Alternative Catalog Number: USB-373338-20,USB-373338-100,USB-373338-1
Manufacturer: US Biological
Category: Molekularbiologie
Growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors. Source: Recombinant protein corresponding to aa89-205 from human VEGFD, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~40.1kD Amino Acid Sequence: FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 40.1
UniProt: O43915
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.