Fimbrial Subunit Type 3, Recombinant, Klebsiella Pneumoniae, aa23-202, His-SUMO-Tag (MrkA)

Product Overview

• Article Name: Fimbrial Subunit Type 3, Recombinant, Klebsiella Pneumoniae, aa23-202, His-SUMO-Tag (MrkA)
• Biozol Catalog Number: USB-373341
• Supplier Catalog Number: 373341
• Alternative Catalog Number: USB-373341-20,USB-373341-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Belongs to the fimbrial protein family. Source: Recombinant protein corresponding to aa23-202 from klebsiella pneumoniae Fimbrial Subunit Type 3, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.5kD Amino Acid Sequence: ADTNVGGGQVNFFGKVTDVSCTVSVNGQGSDANVYLSPVTLTEVKAAAADTYLKPKSFTIDVSDCQAADGTKQDDVSKLGVNWTGGNLLAGATAKQQGYLANTEAAGAQNIQLVLSTDNATALTNKIIPGDSTQPKAAGDASAVQDGARFTYYVGYATSTPTTVTTGVVNSYATYEITYQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 34.5
• UniProt: P12267
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.