Type 1 Fimbrin D-Mannose Specific Adhesin, Recombinant, E. coli, aa22-300 (Protein FimH, FimH)

Catalog Number: USB-373342
Article Name: Type 1 Fimbrin D-Mannose Specific Adhesin, Recombinant, E. coli, aa22-300 (Protein FimH, FimH)
Biozol Catalog Number: USB-373342
Supplier Catalog Number: 373342
Alternative Catalog Number: USB-373342-20,USB-373342-100
Manufacturer: US Biological
Category: Molekularbiologie
Involved in regulation of length and mediation of adhesion of type 1 fimbriae (but not necessary for the production of fimbriae). Adhesin responsible for the binding to D-mannose. It is laterally positioned at intervals in the structure of the type 1 fimbriae. In order to integrate FimH in the fimbriae FimF and FimG are needed. Source: Recombinant protein corresponding to aa22-300 from E. coli Type 1 Fimbrin D-Mannose Specific Adhesin, expressed in Yeast. Molecular Weight: ~29.1kD Amino Acid Sequence: FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.1
UniProt: P08191
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.