FKBP3, Recombinant, Human, aa2-224, His-SUMO-Tag (Peptidyl-prolyl Cis-trans Isomerase FKBP3)

Catalog Number: USB-373347
Article Name: FKBP3, Recombinant, Human, aa2-224, His-SUMO-Tag (Peptidyl-prolyl Cis-trans Isomerase FKBP3)
Biozol Catalog Number: USB-373347
Supplier Catalog Number: 373347
Alternative Catalog Number: USB-373347-20,USB-373347-100,USB-373347-1
Manufacturer: US Biological
Category: Molekularbiologie
FK506- and rapamycin-binding proteins (FKBPs) constitute a family of receptors for the two immunosuppressants which inhibit T-cell proliferation by arresting two distinct Cytoplasmic domain signal transmission pathways. PPIases accelerate the folding of proteins. Source: Recombinant protein corresponding to aa2-224 from human FKBP3, fused to His-SUMO-Tagat N-terminal, expressed in E. coli. Molecular Weight: ~41kD Amino Acid Sequence: AAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKSEETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 41
UniProt: Q00688
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.