GDF9, Recombinant, Human, aa320-454, GST-Tag (Growth/differentiation Factor 9)

Catalog Number: USB-373418
Article Name: GDF9, Recombinant, Human, aa320-454, GST-Tag (Growth/differentiation Factor 9)
Biozol Catalog Number: USB-373418
Supplier Catalog Number: 373418
Alternative Catalog Number: USB-373418-20, USB-373418-100, USB-373418-1
Manufacturer: US Biological
Category: Molekularbiologie
Required for ovarian folliculogenesis. Promotes primordial follicle development. Stimulates granulosa cell proliferation. Promotes cell transition from G0/G1 to S and G2/M phases, through an increase of CCND1 and CCNE1 expression, and RB1 phosphorylation. It regulates STAR expression and cAMP-dependent progesterone release in granulosa and thecal cells. Attenuates the suppressive effects of activin A on STAR expression and progesterone production by increasing the expression of inhibin B. It suppresses FST and FSTL3 production in granulosa-lutein cells. Source: Recombinant protein corresponding to aa320-454 from human GDF9, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.5kD Amino Acid Sequence: GQETVSSELKKPLGPASFNLSEYFRQFLLPQNECELHDFRLSFSQLKWDNWIVAPHRYNPRYCKGDCPRAVGHRYGSPVHTMVQNIIYEKLDSSVPRPSCVPAKYSPLSVLTIEPDGSIAYKEYEDMIATKCTCR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 42.5
UniProt: O60383
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.