Gingipain R2, Recombinant, Porphyromonas Gingivalis, aa230-473, His-SUMO-Tag (RgpB)

Catalog Number: USB-373435
Article Name: Gingipain R2, Recombinant, Porphyromonas Gingivalis, aa230-473, His-SUMO-Tag (RgpB)
Biozol Catalog Number: USB-373435
Supplier Catalog Number: 373435
Alternative Catalog Number: USB-373435-20, USB-373435-100
Manufacturer: US Biological
Category: Molekularbiologie
Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Its proteolytic activity is a major factor in both periodontal tissue destruction and in bacterial host defense mechanisms. Activates complement C3 and C5. Recombinant protein corresponding to aa230-473 from porphyromonas gingivalis Gingipain R2, fused to 6X His-SUMO-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: P95493. Molecular Weight: ~43.3kD Amino Acid Sequence: YTPVEEKENGRMIVIVPKKYEEDIEDFVDWKNQRGLRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDLTYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHYNEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDKWLGQALCIASAEGGPSADNGESDIQHENIIANLLTQYGYTKIIKCYDPGVTPKNIIDAFNGGISLANYTGHGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVAC Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 43.3
UniProt: P95493
Purity: 80% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.