GLI1, Recombinant, Human, aa921-1106, His-Tag (Zinc Finger Protein GLI1)

Catalog Number: USB-373444
Article Name: GLI1, Recombinant, Human, aa921-1106, His-Tag (Zinc Finger Protein GLI1)
Biozol Catalog Number: USB-373444
Supplier Catalog Number: 373444
Alternative Catalog Number: USB-373444-20,USB-373444-100
Manufacturer: US Biological
Category: Molekularbiologie
Acts as a transcriptional activator. May regulate the transcription of specific genes during normal development. May play a role in craniofacial development and digital development, as well as development of the central nervous system and gastrointestinal tract. Mediates SHH signaling and thus cell proliferation and differentiation. Source: Recombinant protein corresponding to aa921-1106 from human Zinc Finger Protein GLI1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~23.3kD Amino Acid Sequence: QEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 23.3
UniProt: P08151
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.