GLO1, Recombinant, Human, aa1-184, GST-Tag (Lactoylglutathione Lyase)

Catalog Number: USB-373447
Article Name: GLO1, Recombinant, Human, aa1-184, GST-Tag (Lactoylglutathione Lyase)
Biozol Catalog Number: USB-373447
Supplier Catalog Number: 373447
Alternative Catalog Number: USB-373447-20,USB-373447-100,USB-373447-1
Manufacturer: US Biological
Category: Molekularbiologie
Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione. Involved in the regulation of TNF-induced transcriptional activity of NF-kappa-B. Required for normal osteoclastogenesis. Full-length recombinant protein corresponding to aa1-184 from human GLO1, fused to GST-Tag at N-terminal, expressed in E. coli. Swiss/UniProt Accession: Q04760. Molecular Weight: ~47.8kD Amino Acid Sequence: MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLM Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 47.8
UniProt: Q04760
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.