GLP1R, Recombinant, Rat, aa22-145, His-Tag (Glucagon-like Peptide 1 Receptor)

Product Overview

• Article Name: GLP1R, Recombinant, Rat, aa22-145, His-Tag (Glucagon-like Peptide 1 Receptor)
• Biozol Catalog Number: USB-373450
• Supplier Catalog Number: 373450
• Alternative Catalog Number: USB-373450-20, USB-373450-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Source: Recombinant protein corresponding to aa22-145 from rat Glp1r, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.1kD Amino Acid Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 15.1
• UniProt: P32301
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.