GLRX3, Recombinant, Human, aa1-335, GST-Tag (Glutaredoxin-3)

Catalog Number: USB-373457
Article Name: GLRX3, Recombinant, Human, aa1-335, GST-Tag (Glutaredoxin-3)
Biozol Catalog Number: USB-373457
Supplier Catalog Number: 373457
Alternative Catalog Number: USB-373457-20, USB-373457-100, USB-373457-1
Manufacturer: US Biological
Category: Molekularbiologie
Critical negative regulator of cardiac hypertrophy and a positive inotropic regulator. Crucial regulator of cellular iron homeostasis and hemoglobin maturation. May play a role in regulating the function of the thioredoxin system. Does not posses any thyoredoxin activity since it lacks the conserved motif that is essential for catalytic activity. Source: Recombinant protein corresponding to aa1-335 from human GLRX3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~64.3kD Amino Acid Sequence: AAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGEN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 64.3
UniProt: O76003
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.