GPR75, Recombinant, Human, aa372-540, His-Tag (Probable G-Protein Coupled Receptor 75)

Catalog Number: USB-373516
Article Name: GPR75, Recombinant, Human, aa372-540, His-Tag (Probable G-Protein Coupled Receptor 75)
Biozol Catalog Number: USB-373516
Supplier Catalog Number: 373516
Alternative Catalog Number: USB-373516-20,USB-373516-100
Manufacturer: US Biological
Category: Molekularbiologie
G protein-coupled receptor that is activated by the chemokine CCL5/RANTES. Probably coupled to heterotrimeric Gq proteins, it stimulates inositol trisphosphate production and calcium mobilization upon activation. Together with CCL5/RANTES, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. CCL5/RANTES may also regulate insulin secretion by pancreatic islet cells through activation of this receptor. Source: Recombinant protein corresponding to aa372-540 from human GPR75, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~20.9kD Amino Acid Sequence: NPFIYSRNSAGLRRKVLWCLQYIGLGFFCCKQKTRLRAMGKGNLEVNRNKSSHHETNSAYMLSPKPQKKFVDQACGPSHSKESMVSPKISAGHQHCGQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPSV Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 20.9
UniProt: O95800
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.