Granzyme B, Recombinant, Human, aa21-247, His-Tag (GZMB)

Catalog Number: USB-373525
Article Name: Granzyme B, Recombinant, Human, aa21-247, His-Tag (GZMB)
Biozol Catalog Number: USB-373525
Supplier Catalog Number: 373525
Alternative Catalog Number: USB-373525-20,USB-373525-100,USB-373525-1
Manufacturer: US Biological
Category: Molekularbiologie
This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Asp. Seems to be linked to an activation cascade of caspases (aspartate-specific cysteine proteases) responsible for apoptosis execution. Cleaves caspase-3, -7, -9 and 10 to give rise to active enzymes mediating apoptosis. Source: Recombinant protein corresponding to aa21-247 from human Granzyme B, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~29.5kD Amino Acid Sequence: IIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVLTAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKRTRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRY Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 29.5
UniProt: P10144
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.