GSTA4, Recombinant, Human, aa1-222, His-SUMO-Tag (Glutathione S-transferase A4)

Catalog Number: USB-373542
Article Name: GSTA4, Recombinant, Human, aa1-222, His-SUMO-Tag (Glutathione S-transferase A4)
Biozol Catalog Number: USB-373542
Supplier Catalog Number: 373542
Alternative Catalog Number: USB-373542-20,USB-373542-100,USB-373542-1
Manufacturer: US Biological
Category: Molekularbiologie
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. This isozyme has a high catalytic efficiency with 4-hydroxyalkenals such as 4-hydroxynonenal (4-HNE). Source: Recombinant protein corresponding to aa1-222 from human GSTA4, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.7kD Amino Acid Sequence: MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVGNQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 41.7
UniProt: O15217
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.