GSTP1, Recombinant, Human, aa2-210, GST-Tag (Glutathione S-transferase P)

Catalog Number: USB-373544
Article Name: GSTP1, Recombinant, Human, aa2-210, GST-Tag (Glutathione S-transferase P)
Biozol Catalog Number: USB-373544
Supplier Catalog Number: 373544
Alternative Catalog Number: USB-373544-20,USB-373544-100,USB-373544-1
Manufacturer: US Biological
Category: Molekularbiologie
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Regulates negatively CDK5 activity via p25/p35 translocation to prevent neurodegeneration. Source: Recombinant protein corresponding to aa2-210 from human GSTP1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~50.2kD Amino Acid Sequence: PPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 50.2
UniProt: P09211
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.