H2-K1, Recombinant, Mouse, aa22-305, GST-Tag (H-2 Class I Histocompatibility Antigen, K-D alpha Chain)

Catalog Number: USB-373570
Article Name: H2-K1, Recombinant, Mouse, aa22-305, GST-Tag (H-2 Class I Histocompatibility Antigen, K-D alpha Chain)
Biozol Catalog Number: USB-373570
Supplier Catalog Number: 373570
Alternative Catalog Number: USB-373570-20,USB-373570-100
Manufacturer: US Biological
Category: Molekularbiologie
Involved in the presentation of foreign antigens to the immune system. Source: Recombinant protein corresponding to aa22-305 from mouse H-2 Class I Histocompatibility Antigen, K-D alpha Chain, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~60kD Amino Acid Sequence: GPHSLRYFVTAVSRPGLGEPRFIAVGYVDDTQFVRFDSDADNPRFEPRAPWMEQEGPEYWEEQTQRAKSDEQWFRVSLRTAQRYYNQSKGGSHTFQRMFGCDVGSDWRLLRGYQQFAYDGRDYIALNEDLKTWTAADTAALITRRKWEQAGDAEYYRAYLEGECVEWLRRYLELGNETLLRTDSPKAHVTYHPRSQVDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWAAVVVPLGKEQNYTCHVHHKGLPEPLTLRWKLPPSTVSNT Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 60
UniProt: P01902
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.