H2AFX, Recombinant, Human, aa12-141, His-Tag (Histone H2AX)

Catalog Number: USB-373574
Article Name: H2AFX, Recombinant, Human, aa12-141, His-Tag (Histone H2AX)
Biozol Catalog Number: USB-373574
Supplier Catalog Number: 373574
Alternative Catalog Number: USB-373574-20, USB-373574-100
Manufacturer: US Biological
Category: Molekularbiologie
Variant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Required for checkpoint-mediated arrest of cell cycle progression in response to low doses of ionizing radiation and for efficient repair of DNA double strand breaks (DSBs) specifically when modified by C-terminal phosphorylation. Partial recombinant protein corresponding to aa12-141 from human H2AFX, fused to 6X His-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot: P16104 Molecular Weight: ~17.8kD Amino Acid Sequence: RAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQ Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 17.8
UniProt: P16104
Purity: 90% (SDS-PAGE)
Form: Supplied as a liquid in 10mM Tris-HCl, 1mM EDTA, pH8.0, 50% glycerol