H3F3A, Recombinant, Human, aa2-136, His-SUMO-Tag (Histone H3.3)

Catalog Number: USB-373577
Article Name: H3F3A, Recombinant, Human, aa2-136, His-SUMO-Tag (Histone H3.3)
Biozol Catalog Number: USB-373577
Supplier Catalog Number: 373577
Alternative Catalog Number: USB-373577-20, USB-373577-100, USB-373577-1
Manufacturer: US Biological
Category: Molekularbiologie
Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. Constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacent throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Source: Recombinant protein corresponding to aa2-136 from human H3F3A, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.2kD Amino Acid Sequence: ARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 31.2
UniProt: P84243
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.