Hba, Recombinant, Mouse, aa2-142, His-Tag (Hemoglobin Subunit alpha)

Catalog Number: USB-373594
Article Name: Hba, Recombinant, Mouse, aa2-142, His-Tag (Hemoglobin Subunit alpha)
Biozol Catalog Number: USB-373594
Supplier Catalog Number: 373594
Alternative Catalog Number: USB-373594-20, USB-373594-100
Manufacturer: US Biological
Category: Molekularbiologie
Involved in oxygen transport from the lung to the various peripheral tissues. Source: Recombinant protein corresponding to aa2-142 from mouse Hemoglobin Subunit alpha, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~17kD Amino Acid Sequence: VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSHGSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKLLSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 17
UniProt: P01942
Purity: 85% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.