Hemopexin, Recombinant, Rat, aa24-460, His-Tag (Hpx)

Product Overview

• Article Name: Hemopexin, Recombinant, Rat, aa24-460, His-Tag (Hpx)
• Biozol Catalog Number: USB-373617
• Supplier Catalog Number: 373617
• Alternative Catalog Number: USB-373617-20,USB-373617-100
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Binds heme and transports it to the liver for breakdown and iron recovery, after which the free hopexin returns to the circulation. Recombinant protein corresponding to aa24-460 from rat Hemopexin, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~52.9kD Amino Acid Sequence: NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDATTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNPVTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYPKLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQGNRKWFWDFATRTQKERSWPAVGNCTAALRWLERYYCFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGRGHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDHRGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGPSAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSGYPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVTSGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLEKSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAAKSLPQPQKVNSILGCSQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 52.9
• UniProt: P20059
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.