HIST1H2AG, Recombinant, Human, aa2-130, His-Tag (Histone H2A Type 1)

Product Overview

• Article Name: HIST1H2AG, Recombinant, Human, aa2-130, His-Tag (Histone H2A Type 1)
• Biozol Catalog Number: USB-373628
• Supplier Catalog Number: 373628
• Alternative Catalog Number: USB-373628-20,USB-373628-100,USB-373628-1
• Manufacturer: US Biological
• Category: Molekularbiologie

Product Description

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.. Source: Recombinant protein corresponding to aa2-130 from human HIST1H2AG, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18kD Amino Acid Sequence: SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Product Properties

• Molecular Weight: 18
• UniProt: P0C0S8
• Purity: 90% (SDS-PAGE)
• Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.