HIST1H2BB, Recombinant, Human, aa2-126, His-SUMO-Tag (Histone H2B Type 1-B)
Biozol Catalog Number:
USB-373629
Supplier Catalog Number:
373629
Alternative Catalog Number:
USB-373629-20,USB-373629-100,USB-373629-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Full-length recombinant protein corresponding to aa2-126 from human HIST1H2BB, fused to 6XHis-SUMO-Tag at N-terminal, expressed in E. coli. Accession/Uniprot: P33778 Molecular Weight: ~29.8kD Amino Acid Sequence: PEPSKSAPAPKKGSKKAITKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.