HLA-C, Recombinant, Human, aa25-308, His-Tag (HLA-C Protein, MHC Class I Antigen)
Biozol Catalog Number:
USB-373640
Supplier Catalog Number:
373640
Alternative Catalog Number:
USB-373640-20,USB-373640-100,USB-373640-1
Manufacturer:
US Biological
Category:
Molekularbiologie
Involved in the presentation of foreign antigens to the immune system. SAAS annotation. Partial recombinant protein corresponding to aa25-308 from human HLA-C, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.7kD Amino Acid Sequence: CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
* VAT and and shipping costs not included. Errors and price changes excepted