Hras, Recombinant, Rat, aa2-186, His-Tag (GTPase HRas)

Catalog Number: USB-373682
Article Name: Hras, Recombinant, Rat, aa2-186, His-Tag (GTPase HRas)
Biozol Catalog Number: USB-373682
Supplier Catalog Number: 373682
Alternative Catalog Number: USB-373682-20,USB-373682-100
Manufacturer: US Biological
Category: Molekularbiologie
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Source: Recombinant protein corresponding to aa2-186 from rat Hras, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.9kD Amino Acid Sequence: TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 24.9
UniProt: P20171
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.