Hrp1, Recombinant, Mycobacterium tuberculosis, aa1-143, His-SUMO-Tag, Myc-Tag (Hypoxic Response Protein 1)

Catalog Number: USB-373683
Article Name: Hrp1, Recombinant, Mycobacterium tuberculosis, aa1-143, His-SUMO-Tag, Myc-Tag (Hypoxic Response Protein 1)
Biozol Catalog Number: USB-373683
Supplier Catalog Number: 373683
Alternative Catalog Number: USB-373683-20,USB-373683-100
Manufacturer: US Biological
Category: Molekularbiologie
Unlike some other CBS-domain containing proteins does not seem to bind AMP. Source: Recombinant protein corresponding to aa1-143 from full length mycobacterium tubervulosis Hrp1, fused to 10xHis-SUMO-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~35.5kD Amino Acid Sequence: MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 35.5
UniProt: P9WJA3
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.