HSD17B11, Recombinant, Human, aa20-300, His-SUMO-Tag (Estradiol 17-beta-dehydrogenase 11)

Catalog Number: USB-373688
Article Name: HSD17B11, Recombinant, Human, aa20-300, His-SUMO-Tag (Estradiol 17-beta-dehydrogenase 11)
Biozol Catalog Number: USB-373688
Supplier Catalog Number: 373688
Alternative Catalog Number: USB-373688-20,USB-373688-100,USB-373688-1
Manufacturer: US Biological
Category: Molekularbiologie
Can convert androstan-3-alpha,17-beta-diol (3-alpha-diol) to androsterone in vitro, suggesting that it may participate in androgen metabolism during steroidogenesis. May act by metabolizing compounds that stimulate steroid synthesis and/or by generating metabolites that inhibit it. Has no activity toward DHEA (dehydroepiandrosterone), or A-dione (4-androste-3,17-dione), and only a slight activity toward testosterone to A-dione. Tumor-associated antigen in cutaneous T-cell lymphoma. Source: Recombinant protein corresponding to aa20-300 from human HSD17B11, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~46.8kD Amino Acid Sequence: ESFVKLFIPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKQKISVKFDAVIGYKMKAQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 46.8
UniProt: Q8NBQ5
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.