HSD17B14, Recombinant, Human, aa1-270, His-SUMO-Tag (17-Beta-Hydroxysteroid Dehydrogenase 14)

Catalog Number: USB-373689
Article Name: HSD17B14, Recombinant, Human, aa1-270, His-SUMO-Tag (17-Beta-Hydroxysteroid Dehydrogenase 14)
Biozol Catalog Number: USB-373689
Supplier Catalog Number: 373689
Alternative Catalog Number: USB-373689-20,USB-373689-100,USB-373689-1
Manufacturer: US Biological
Category: Molekularbiologie
Has NAD-dependent 17-beta-hydroxysteroid dehydrogenase activity. Converts oestradiol to oestrone. The physiological substrate is not known. Acts on oestradiol and 5-androstene-3-beta,17-beta-diol (in vitro). Source: Recombinant protein corresponding to aa1-270 from human HSD17B14, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~44.3kD Amino Acid Sequence: MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVKTLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINISSLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGMLAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molecular Weight: 44.3
UniProt: Q9BPX1
Purity: 90% (SDS-PAGE)
Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.